PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19715.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 341aa    MW: 38045.6 Da    PI: 6.9159
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19715.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171360148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEd++l++ v+ +G g+W+++++  g+ R++k+c++rw +yl
  mrna19715.1-v1.0-hybrid 13 RGLWSPEEDDKLIKHVTTHGHGSWSSVPKNAGLERCGKSCRLRWINYL 60
                             788*******************************************97 PP

2Myb_DNA-binding54.52.7e-1766110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg++T eE+++++d+++ lG+ +W+ Ia++++ gRt++++k++w++
  mrna19715.1-v1.0-hybrid  66 RGSFTSEEEQIIIDVHRILGNSRWAQIAKHLP-GRTDNEVKNFWNS 110
                              89******************************.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-25563IPR009057Homeodomain-like
PROSITE profilePS5129418.118860IPR017930Myb domain
SuperFamilySSF466892.6E-2811108IPR009057Homeodomain-like
SMARTSM007171.3E-131262IPR001005SANT/Myb domain
PfamPF002498.3E-161360IPR001005SANT/Myb domain
CDDcd001672.10E-111660No hitNo description
PROSITE profilePS5129424.9561116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2564116IPR009057Homeodomain-like
SMARTSM007173.4E-1565114IPR001005SANT/Myb domain
PfamPF002491.5E-1566110IPR001005SANT/Myb domain
CDDcd001674.48E-1368109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGHRCCGKHK VKRGLWSPEE DDKLIKHVTT HGHGSWSSVP KNAGLERCGK SCRLRWINYL  60
RPELKRGSFT SEEEQIIIDV HRILGNSRWA QIAKHLPGRT DNEVKNFWNS CIKKKLMSQG  120
LDPQTHNLIS SHKRSVASNK TAGSNAKTQS HIDQERPVFT VNNMSQKTDS STEMNYSMST  180
PIVPLLNAQP PTVQSMMASP TNNNHYLVQN PNSGWNNVSD IPTFPDSTLN MSSASSSSMF  240
GHMDDSNCIW AAGAEAYVPA PGAMEVQGEQ SKGQVVQVHQ EKEKLLEMEM EAMQDMEIAA  300
SFDQCSSFDY SLVEYYSTMM SGVAPHDHVN YSAADFTWNF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30131167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293853.10.0PREDICTED: myb-related protein 330-like
TrEMBLM5WK831e-130M5WK83_PRUPE; Uncharacterized protein
STRINGVIT_19s0085g00940.t014e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.14e-88myb domain protein 67